PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN19227.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 359aa    MW: 40985.3 Da    PI: 4.5208
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN19227.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEd++l ++++  G g+W++ +   g+ R++k+c++rw +yl
       KHN19227.1 14 KGRWTEEEDDILTKYIQANGEGSWRSLPTNSGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding48.91.5e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + eE+ +++++++ +G++ W++Ia++++ gRt++++k++w+++l
       KHN19227.1  67 RGNISFEEESIILKLHASFGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                      788899****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-20564IPR009057Homeodomain-like
PROSITE profilePS5129415.751961IPR017930Myb domain
SuperFamilySSF466893.12E-2711108IPR009057Homeodomain-like
SMARTSM007172.9E-111363IPR001005SANT/Myb domain
PfamPF002493.4E-131461IPR001005SANT/Myb domain
CDDcd001671.16E-71661No hitNo description
PROSITE profilePS5129424.12962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2465116IPR009057Homeodomain-like
SMARTSM007172.2E-1666114IPR001005SANT/Myb domain
PfamPF002495.6E-1467112IPR001005SANT/Myb domain
CDDcd001676.57E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MVRAPCCEKV GLKKGRWTEE EDDILTKYIQ ANGEGSWRSL PTNSGLLRCG KSCRLRWINY  60
LRADLKRGNI SFEEESIILK LHASFGNRWS LIASHLPGRT DNEIKNYWNS HLSRKIYTFH  120
GTTSSSKDII ITLPPRRKRG RSSRWAMKKN KQQQIHTTHN NEVAVPLPPT PPLIETEKYL  180
STNIMLMEEQ FDGSSTASTI THQHENNINT TQEEEEEQNE GVEEGEKEEI INEDIWGPCD  240
EEVINGGEVV LNFDDIMDNC YFQEASGVWT ISDHEQRESN DNINVAGNEK GVDDTCTNIV  300
MSSGDDDQLH SSSFMASGLD QNLLTWLWED EDWDTDLQSL GEIHSDKLKA MVDWFLSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-23121162105MYB PROTO-ONCOGENE PROTEIN
1msf_C9e-23121162105C-Myb DNA-Binding Domain
1mse_C9e-23121162105C-Myb DNA-Binding Domain
1h8a_C1e-221211625128MYB TRANSFORMING PROTEIN
1h89_C2e-221211656159MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-221211656159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006577161.10.0PREDICTED: transcription factor MYB12
TrEMBLA0A0B2QHJ40.0A0A0B2QHJ4_GLYSO; Transcription factor MYB12
STRINGGLYMA03G37640.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.13e-73myb domain protein 111
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]